← All .science files
pmid:26909372
Supporting data for the MS identification of distinct transferrin glycopeptide glycoforms and citrullinated peptides associated with inflammation or autoimmunity.
A Rosal-Vela · A Barroso · E Giménez · S García-Rodríguez · V Longobardo · J Postigo · M Iglesias · A Lario · J Merino · R Merino · M Zubiaur · V Sanz-Nebot · J Sancho
Data in brief · 2016 doi:10.1016/j.dib.2015.12.045
Paper
complete
Experiment
partial
Data
partial
Analysis
complete
Execution
absent
Execution evidence has not yet been added to this .science file. Explore its methods, data and open questions to plan the next step.
Record details sci_version · id · kind · revision · content_hash · schema · created_at · updated_at · generator
paper object · 10 fields
authors array · 13 items
claims array · 2 items
[0] object · 6 fields
[1] object · 6 fields
gaps array · 0 items
experiment object · 8 fields
steps array · 3 items
[0] object · 13 fields
parameters object · 0 fields
inputs array · 1 item
outputs array · 1 item
instruments array · 0 items
reagents array · 0 items
[1] object · 13 fields
parameters object · 0 fields
inputs array · 0 items
outputs array · 1 item
instruments array · 0 items
reagents array · 0 items
[2] object · 13 fields
parameters object · 0 fields
inputs array · 0 items
outputs array · 1 item
instruments array · 0 items
reagents array · 0 items
materials array · 0 items
instruments array · 0 items
reagents array · 0 items
conditions object · 0 fields
gaps array · 1 item
data object · 3 fields
assets array · 14 items
[0] object · 15 fields
structure object · 4 fields
[1] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 27 items
[0] array · 11 items
[1] array · 11 items
[2] array · 11 items
[3] array · 11 items
[4] array · 11 items
[5] array · 11 items
[6] array · 11 items
[7] array · 11 items
[8] array · 11 items
[9] array · 11 items
[10] array · 11 items
[11] array · 11 items
[12] array · 11 items
[13] array · 11 items
[14] array · 11 items
[15] array · 11 items
[16] array · 11 items
[17] array · 11 items
[18] array · 11 items
[19] array · 11 items
[20] array · 11 items
[21] array · 11 items
[22] array · 11 items
[23] array · 11 items
[24] array · 11 items
[25] array · 11 items
[26] array · 1 item
[2] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 22 items
[0] array · 9 items
[1] array · 9 items
[2] array · 9 items
[3] array · 9 items
[4] array · 9 items
[5] array · 9 items
[6] array · 9 items
[7] array · 9 items
[8] array · 9 items
[9] array · 9 items
[10] array · 9 items
[11] array · 9 items
[12] array · 9 items
[13] array · 9 items
[14] array · 9 items
[15] array · 9 items
[16] array · 9 items
[17] array · 9 items
[18] array · 9 items
[19] array · 9 items
[20] array · 9 items
[21] array · 9 items
[3] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 6 items
[0] array · 10 items
[1] array · 10 items
[2] array · 10 items
[3] array · 10 items
[4] array · 10 items
[5] array · 10 items
[4] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 31 items
[0] array · 3 items
[1] array · 3 items
[2] array · 3 items
[3] array · 3 items
[4] array · 3 items
[5] array · 3 items
[6] array · 3 items
[7] array · 3 items
[8] array · 3 items
[9] array · 3 items
[10] array · 3 items
[11] array · 3 items
[12] array · 3 items
[13] array · 3 items
[14] array · 3 items
[15] array · 3 items
[16] array · 3 items
[17] array · 3 items
[18] array · 3 items
[19] array · 3 items
[20] array · 3 items
[21] array · 3 items
[22] array · 3 items
[23] array · 3 items
[24] array · 3 items
[25] array · 3 items
[26] array · 3 items
[27] array · 3 items
[28] array · 3 items
[29] array · 3 items
[30] array · 3 items
[5] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 10 items
[0] array · 3 items
[1] array · 3 items
[2] array · 3 items
[3] array · 3 items
[4] array · 3 items
[5] array · 3 items
[6] array · 3 items
[7] array · 3 items
[8] array · 3 items
[9] array · 3 items
[6] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 13 items
[0] array · 5 items
[1] array · 5 items
[2] array · 5 items
[3] array · 5 items
[4] array · 5 items
[5] array · 5 items
[6] array · 5 items
[7] array · 5 items
[8] array · 5 items
[9] array · 5 items
[10] array · 5 items
[11] array · 5 items
[12] array · 5 items
[7] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 31 items
[0] array · 4 items
[1] array · 4 items
[2] array · 4 items
[3] array · 4 items
[4] array · 4 items
[5] array · 4 items
[6] array · 4 items
[7] array · 4 items
[8] array · 4 items
[9] array · 4 items
[10] array · 4 items
[11] array · 4 items
[12] array · 4 items
[13] array · 4 items
[14] array · 4 items
[15] array · 4 items
[16] array · 4 items
[17] array · 4 items
[18] array · 4 items
[19] array · 4 items
[20] array · 4 items
[21] array · 4 items
[22] array · 4 items
[23] array · 4 items
[24] array · 4 items
[25] array · 4 items
[26] array · 4 items
[27] array · 4 items
[28] array · 4 items
[29] array · 4 items
[30] array · 4 items
[8] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 15 items
[0] array · 4 items
[1] array · 4 items
[2] array · 4 items
[3] array · 4 items
[4] array · 4 items
[5] array · 4 items
[6] array · 4 items
[7] array · 4 items
[8] array · 4 items
[9] array · 4 items
[10] array · 4 items
[11] array · 4 items
[12] array · 4 items
[13] array · 4 items
[14] array · 4 items
[9] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 10 items
[0] array · 4 items
[1] array · 4 items
[2] array · 4 items
[3] array · 4 items
[4] array · 4 items
[5] array · 4 items
[6] array · 4 items
[7] array · 4 items
[8] array · 4 items
[9] array · 4 items
[10] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 16 items
[0] array · 11 items
[1] array · 1 item
[2] array · 11 items
[3] array · 11 items
[4] array · 11 items
[5] array · 11 items
[6] array · 11 items
[7] array · 11 items
[8] array · 11 items
[9] array · 11 items
[10] array · 11 items
[11] array · 11 items
[12] array · 11 items
[13] array · 11 items
[14] array · 11 items
[15] array · 11 items
[11] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 6 items
[0] array · 10 items
[1] array · 1 item
[2] array · 10 items
[3] array · 10 items
[4] array · 10 items
[5] array · 10 items
[12] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 81 items
[0] array · 1 item
[1] array · 2 items
[2] array · 2 items
[3] array · 2 items
[4] array · 2 items
[5] array · 2 items
[6] array · 2 items
[7] array · 2 items
[8] array · 2 items
[9] array · 2 items
[10] array · 2 items
[11] array · 2 items
[12] array · 2 items
[13] array · 2 items
[14] array · 2 items
[15] array · 2 items
[16] array · 2 items
[17] array · 2 items
[18] array · 2 items
[19] array · 2 items
[20] array · 2 items
[21] array · 2 items
[22] array · 2 items
[23] array · 2 items
[24] array · 2 items
[25] array · 2 items
[26] array · 2 items
[27] array · 2 items
[28] array · 2 items
[29] array · 2 items
[30] array · 2 items
[31] array · 2 items
[32] array · 2 items
[33] array · 2 items
[34] array · 2 items
[35] array · 2 items
[36] array · 2 items
[37] array · 2 items
[38] array · 2 items
[39] array · 2 items
[40] array · 2 items
[41] array · 2 items
[42] array · 2 items
[43] array · 2 items
[44] array · 2 items
[45] array · 2 items
[46] array · 2 items
[47] array · 2 items
[48] array · 2 items
[49] array · 2 items
[50] array · 2 items
[51] array · 2 items
[52] array · 2 items
[53] array · 2 items
[54] array · 2 items
[55] array · 2 items
[56] array · 2 items
[57] array · 2 items
[58] array · 2 items
[59] array · 2 items
[60] array · 2 items
[61] array · 2 items
[62] array · 2 items
[63] array · 2 items
[64] array · 2 items
[65] array · 2 items
[66] array · 2 items
[67] array · 2 items
[68] array · 2 items
[69] array · 2 items
[70] array · 2 items
[71] array · 2 items
[72] array · 2 items
[73] array · 2 items
[74] array · 2 items
[75] array · 2 items
[76] array · 2 items
[77] array · 2 items
[78] array · 2 items
[79] array · 2 items
[80] array · 2 items
[13] object · 16 fields
structure object · 5 fields
table object · 8 fields
rows array · 8 items
[0] array · 6 items
[1] array · 10 items
[2] array · 11 items
[3] array · 11 items
[4] array · 11 items
[5] array · 11 items
[6] array · 11 items
[7] array · 11 items
gaps array · 0 items
analysis object · 4 fields
methods array · 1 item
[0] object · 10 fields
dsl_operations array · 4 items
missing_operations array · 0 items
parameters object · 0 fields
data_shapes array · 1 item
targets array · 0 items
gaps array · 0 items
capability object · 3 fields
requirements array · 1 item
[0] object · 6 fields
assay_families array · 9 items
gaps array · 0 items
readiness object · 8 fields
axes object · 3 fields
method object · 5 fields
required_operations array · 4 items
missing_operations array · 0 items
capability object · 4 fields
data object · 6 fields
accessions array · 4 items
resolved_accessions array · 0 items
statements array · 1 item
can_run object · 3 fields
dsl_operations array · 4 items
assets array · 14 items
steps array · 1 item
must_build object · 5 fields
dsl_operations array · 0 items
converters array · 0 items
readers array · 0 items
capabilities array · 0 items
data_gaps array · 1 item
gaps array · 1 item
review object · 5 fields
machine_critique object · 5 fields
reader object · 5 fields
evidence_check object · 2 fields
usage object · 3 fields
stages array · 1 item
[0] object · 4 fields
gaps array · 3 items
provenance object · 7 fields
entities array · 3 items
activities array · 3 items
[0] object · 4 fields
used array · 3 items
[0] object · 3 fields
[1] object · 3 fields
[2] object · 3 fields
[1] object · 4 fields
agents array · 2 items
lineage object · 4 fields
gaps array · 5 items
assays array · 2 items
[0] object · 11 fields
required_operations array · 0 items
source_hashes object · 1 field
evidence array · 1 item
[1] object · 11 fields
required_operations array · 4 items
source_hashes object · 1 field
evidence array · 1 item
Complete file
{"sci_version": "1.2", "schema": "https://corpus.bntrg.co.uk/sci/1.0/sci.schema.json", "id": "pmid:26909372", "kind": "science-record", "revision": 8, "content_hash": "sha256:f717ce48b8eb58ec058b8715e610da7f30e98dbfe60504dcd31f52ed0035864a", "created_at": "2026-11-01T15:40:16Z", "updated_at": "2026-11-01T22:42:34Z", "generator": {"name": "corpus-assay-engine", "run_id": "reading-sci-2026-11-01"}, "paper": {"state": "complete", "title": "Supporting data for the MS identification of distinct transferrin glycopeptide glycoforms and citrullinated peptides associated with inflammation or autoimmunity.", "doi": "10.1016/j.dib.2015.12.045", "pmid": "26909372", "authors": ["A Rosal-Vela", "A Barroso", "E Giménez", "S García-Rodríguez", "V Longobardo", "J Postigo", "M Iglesias", "A Lario", "J Merino", "R Merino", "M Zubiaur", "V Sanz-Nebot", "J Sancho"], "journal": "Data in brief", "year": 2016, "abstract": "This data article presents the results of all the statistical analyses applied to the relative intensities of the detected 2D-DiGE protein spots for each of the 3 performed DiGE experiments. The data reveals specific subsets of protein spots with significant differences between WT and CD38-deficient mice with either Collagen-induced arthritis (CIA), or with chronic inflammation induced by CFA, or under steady-state conditions. This article also shows the MS data analyses that allowed the identification of the protein species which serve to discriminate the different experimental groups used in this study. Moreover, the article presents MS data on the citrullinated peptides linked to specific protein species that were generated in CIA(+) or CFA-treated mice. Lastly, this data article provides MS data on the efficiency of the analyses of the transferrin (Tf) glycopeptide glycosylation pattern in spleen and serum from CIA(+) mice and normal controls. The data supplied in this work is related to the research article entitled \"identification of multiple transferrin species in spleen and serum from mice with collagen-induced arthritis which may reflect changes in transferrin glycosylation associated with disease activity: the role of CD38\" [1]. All mass spectrometry data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository with identifiers PRIDE: PXD002644, PRIDE: PXD002643, PRIDE: PXD003183 and PRIDE: PXD003163.", "claims": [{"id": "claim-method", "statement": "Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice.", "kind": "methodological", "target": null, "evidence": [{"asset": "source:pmid:26909372", "locator": "sections[5] \"Data\" paragraph 8", "quote": "Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice."}], "state": "complete"}, {"id": "claim-data-access", "statement": "Data is within this article. Data also available at the ProteomeXchange Consortium via the PRIDE partner repository, PRIDE: PXD002644, PRIDE: PXD002643, PRIDE: PXD003183 and PRIDE: PXD003163.", "kind": "methodological", "target": null, "evidence": [{"asset": "source:pmid:26909372", "locator": "sections[2] \"table-wrap\" paragraph 1", "quote": "Data is within this article. Data also available at the ProteomeXchange Consortium via the PRIDE partner repository, PRIDE: PXD002644, PRIDE: PXD002643, PRIDE: PXD003183 and PRIDE: PXD003163."}], "state": "complete"}], "gaps": []}, "experiment": {"state": "partial", "objective": "", "steps": [{"id": "read_published_estimate", "order": 1, "name": "Read the published estimate from the source", "kind": "other", "state": "complete", "blocked_on": null, "description": "The claim, method and evidence span published with the source article.", "duration_hours": null, "parameters": {}, "inputs": ["source:pmid:26909372"], "outputs": ["the published estimate and its evidence"], "instruments": [], "reagents": []}, {"id": "obtain_source_data", "order": 2, "name": "Obtain the source data from the named repository", "kind": "data-preparation", "state": "blocked", "blocked_on": "data:accession_absent", "description": "The GEO series accession resolves and its sample accessions are listed. This lane did not download the dataset or read its licence.", "duration_hours": null, "parameters": {}, "inputs": [], "outputs": ["the source data with its repository provenance"], "instruments": [], "reagents": []}, {"id": "run_analysis", "order": 3, "name": "Run the published analysis", "kind": "analysis", "state": "complete", "blocked_on": null, "description": "Apply the paper's statistical method to the resolved series and compare the result with the published target.", "duration_hours": null, "parameters": {}, "inputs": [], "outputs": ["the replicated result and its comparison"], "instruments": [], "reagents": []}], "materials": [], "instruments": [], "reagents": [], "conditions": {}, "gaps": ["step:obtain_source_data blocked on data:accession_absent"]}, "data": {"state": "partial", "assets": [{"id": "source:pmid:26909372", "role": "manuscript", "format": "xml", "media_type": "application/xml", "uri": "https://doi.org/10.1016/j.dib.2015.12.045", "sha256": "sha256:dcd7ea645bff339f963189a79f1f8de2c5fe3eab474b5505357122763101392d", "bytes": 22652, "access": "open", "state": "resolved", "reader": null, "reader_status": "reader_required", "identifier": "10.1016/j.dib.2015.12.045", "version": null, "note": "Full article fetched from PMC; the checksum covers the rendered section body, not the original XML bytes.", "structure": {"pmcid": "PMC4731419", "source": "europe_pmc_fulltext", "coverage": "whole_body", "text_hash_scope": "rendered_section_body"}}, {"id": "asset:table:pmid:26909372:1", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:cdb59b6252143fd6a1a8fc1c64a4f0433d4a2a9f5d6a716ff593fd53f9899b9d", "bytes": 3060, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[1]#t0005", "version": null, "note": "Protein spots from mouse spleen identified by MS/MS using the 4800 MALDI-TOF/TOF (AB Sciex).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 27, "column_count": 11}, "table": {"label": "Table 1", "caption": "Protein spots from mouse spleen identified by MS/MS using the 4800 MALDI-TOF/TOF (AB Sciex).", "rows": [["Spot numbera", "Identification", "Accession", "Accension numberb", "Protein score", "Protein score CI%c", "Pep.count", "Total ion scored", "Total %ion CI", "MW (theorical)e", "IEP (theorical)e"], ["533", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "119", "100", "11", "69", "100.000", "78840.5", "6.94"], ["537", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "217", "100", "18", "109", "100.000", "78840.5", "6.94"], ["539", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "461", "100", "25", "266", "100.000", "78840.5", "6.94"], ["614", "Stress-induced-phosphoprotein 1", "STIP1_MOUSE", "Q60864", "277", "100", "19", "146", "100", "63,170", "6.40"], ["692", "Fibrinogen beta chain", "FIBB_MOUSE", "Q8K0E8", "800", "100", "25", "578", "100", "55401.9", "6.68"], ["697", "Catalase", "CATA_MOUSE", "P24270", "179", "100", "10", "131", "100", "60012.7", "7.72"], ["778", "Alpha enolase", "ENOA_MOUSE", "P17182", "891", "100", "27", "594", "100", "47453.3", "6.37"], ["", "Beta enolase", "ENOB_MOUSE", "P21550", "250", "100", "6", "224", "100", "47337.4", "6.73"], ["", "Gamma enolase", "ENOG_MOUSE", "P17183", "94", "100", "5", "75", "100", "47609.1", "4.99"], ["906", "Voltage-dependent anion selective channel protein 2", "VDAC2_MOUSE", "Q60930", "179", "100", "11", "95", "100", "32339.80", "7"], ["981", "Proteasome subunit alpha type-1", "PSA1_MOUSE", "Q9R1P4", "426", "100", "10", "350", "100.000", "29812.9", "6"], ["982", "Carbonic anhydrase 2", "CAH2_MOUSE", "P00920", "478", "100", "17", "295", "100.000", "29128.5", "6.49"], ["", "Carbonic anhydrase 1", "CAH1_MOUSE", "P13634", "203", "100", "7", "155", "100.000", "28360.2", "6.44"], ["1001", "Proteasome subunit alpha type-6", "PSA6_MOUSE", "Q9QUM9", "335", "100", "10", "264", "100.000", "27,811", "6.34"], ["", "Pyridoxine-5′-phosphate oxidase", "PNPO_MOUSE", "Q91XF0", "81", "99.999", "5", "57", "99.999", "30437.1", "8.46"], ["1063", "Flavin reductase", "BLVRB_MOUSE", "Q923D2", "777", "100", "16", "583", "100.000", "22297.4", "6.49"], ["1097", "ATP synthase subunit d, mitochondrial", "ATP5H_MOUSE", "Q9DCX2", "243", "100", "10", "156", "100.000", "18794.6", "5.52"], ["1103", "Ferritin light chain 1", "FRIL1_MOUSE", "P29391", "585", "100", "14", "435", "100.000", "20846.5", "5.66"], ["", "Ferritin light chain 2", "FRIL2_MOUSE", "P49945", "276", "100", "9", "202", "100.000", "20886.9", "6.39"], ["1136", "Peptidyl-prolyl cis-trans isomerase A", "PPIA_MOUSE", "P17742", "340", "100", "10", "249", "100", "18130.9000", "8"], ["1147", "Actin-related protein 2/3 complex subunit 5-like protein", "ARP5L_MOUSE", "Q9D898", "165", "100", "6", "116", "100", "17026.80", "6.32"], ["1171", "Nucleoside diphosphate kinase A", "NDKA_MOUSE", "P15532", "654", "100", "13", "518", "100.000", "17310.9", "6.84"], ["", "Nucleoside diphosphate kinase B", "NDKB_MOUSE", "Q01768", "330", "100", "7", "278", "100.000", "17,466", "6.97"], ["1184", "Protein S100-A9", "S10A9_MOUSE", "P31725", "95", "100", "1", "89", "100", "13,211", "6.64"], ["1313", "Protein S100-A8", "S10A8_MOUSE", "P27005", "146", "100", "3", "119", "100.000", "10345.1", "5.43"], [""]], "row_count": 27, "column_count": 11, "numeric_cells": 229, "header_rows": 1, "locator": "section[5]/table-wrap[1]#t0005"}}, {"id": "asset:table:pmid:26909372:2", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:0e7d2be5d5b9700a1d4008dd00840e4b5aa7725012e595200f3bd72940816578", "bytes": 2463, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[2]#t0010", "version": null, "note": "Protein spots identified by MS/MS using the MALDI-TOF/TOF UltrafleXtreme (Bruker).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 22, "column_count": 9}, "table": {"label": "Table 2", "caption": "Protein spots identified by MS/MS using the MALDI-TOF/TOF UltrafleXtreme (Bruker).", "rows": [["Spot numbera", "Identification", "Accession", "Accession numberb", "Protein score", "Sequence coverage (%)", "No. of peptides", "MW (theorical)c", "IEP (theorical)c"], ["501", "Aconitate hydratase, mitochondrial", "ACON_MOUSE", "Q99KI0", "93.05", "3.60", "2", "85,400", "8.08"], ["538", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "96.65", "4", "3", "78,841", "6.94"], ["539", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "190.90", "5.9", "4", "78,841", "6.94"], ["554", "Far upstream element-binding protein 1", "FUBP1_MOUSE", "Q91WJ8", "32.75", "2.00", "1", "68,668", "7.74"], ["633", "Fibrinogen alpha chain", "FIBA_MOUSE", "E9PV24", "123.51", "4.20", "3", "88,117", "5.77"], ["638", "Heterogeneous nuclear ribonucleoprotein L", "HNRPL_MOUSE", "Q8R081", "69.55", "4.60", "2", "64,550", "8.33"], ["732", "Coronin-1", "CORO1A_MOUSE", "gi|4895037", "102.3", "2.2", "1", "51,627", "6.05"], ["738", "Vimentin", "VIME_MOUSE", "P20152", "286.83", "16.10", "5", "53,712", "5.06"], ["770", "Protein disulfide-isomerase A6 precursor", "PDIA6_MOUSE", "gi|58037267", "117.78", "10.6", "3", "49,058", "5.05"], ["898", "Actin, cytoplasmic 1", "ACTB_MOUSE", "P60710", "177.47", "9.10", "2", "42,052", "5.29"], ["", "Beta-actin-like protein 2", "ACTBL_MOUSE", "Q8BFZ3", "129.62", "9.00", "2", "42,319", "5.30"], ["", "F-actin-capping protein subunit alpha-1", "CAZA1_MOUSE", "P47753", "92.04", "9.80", "2", "33,090", "5.34"], ["972", "Tropomyosin alpha-1 chain", "TPM1_MOUSE", "P58771", "59.03", "4.90", "1", "32,718", "4.69"], ["981", "Proteasome subunit alpha type-1", "PSA1_MOUSE", "Q9R1P4", "133.78", "13.7", "3", "29,813", "6.00"], ["1001", "Proteasome subunit alpha type-6", "PSA6_MOUSE", "Q9QUM9", "177.79", "16.3", "4", "27,811", "6.34"], ["1049", "Proteasome subunit beta type-10", "PSB10_MOUSE", "O35955", "109.4", "8.80", "3", "29,330", "6.40"], ["", "Growth factor receptor-bound protein 2", "GRB2_MOUSE", "Q60631", "103.47", "11.50", "3", "25,336", "5.89"], ["1103", "Ferritin light chain 1", "FRIL1_MOUSE", "P29391", "48.36", "4.4", "1", "20,847", "5.66"], ["1150", "E3 ubiquitin-protein ligase RNF181", "RN181_MOUSE", "Q9CY62", "26.01", "4.80", "1", "19,487", "5.65"], ["1173", "Ubiquitin-conjugating enzyme E2 N", "UBE2N_MOUSE", "P61089", "104.79", "19.70", "2", "17,184", "6.13"], ["1302", "N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)", "ACY3_MOUSE", "Q91XE4", "23.11", "2.50", "1", "35,720", "5.30"]], "row_count": 22, "column_count": 9, "numeric_cells": 155, "header_rows": 1, "locator": "section[5]/table-wrap[2]#t0010"}}, {"id": "asset:table:pmid:26909372:3", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:1ac1d024bc1d37e2e5f92536b036075c0fc0ba9715a8ae37a86498233aec1be8", "bytes": 939, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[3]#t0015", "version": null, "note": "Protein spots identified by PMF using the MALDI-TOF/TOF UltrafleXtreme (Bruker).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 6, "column_count": 10}, "table": {"label": "Table 3", "caption": "Protein spots identified by PMF using the MALDI-TOF/TOF UltrafleXtreme (Bruker).", "rows": [["Spot numbera", "Protein name", "Accession numberb", "MW(theorical)c", "IEP(theorical)c", "Score", "Expect", "Sequence coverage", "Queries matched", "Queries searched"], ["572", "Prelamin-A/C isoform A precursor (MS)", "gi|162287370", "74,478", "6.54", "77", "0.0034", "29", "18", "73"], ["", "Prelamin-A/C isoform C (MS)", "gi|161760667", "65,464", "6.37", "69", "0.02", "33", "17", "73"], ["", "Fibroblast growth factor 22 (MS)", "gi|12963627", "18,972", "11.73", "72", "0.011", "61", "10", "73"], ["983", "Mitochondrial peptide methionine sulfoxide reductase", "Q9D6Y7", "26,200", "8.6", "76", "0.00042", "34.3", "7", "37"], ["1104", "Low molecular weight phosphotyrosine protein phosphatase", "Q9D358", "18,636", "6.30", "58.5", "2.40E−02", "31.6", "5", "35"]], "row_count": 6, "column_count": 10, "numeric_cells": 43, "header_rows": 1, "locator": "section[5]/table-wrap[3]#t0015"}}, {"id": "asset:table:pmid:26909372:4", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:386a3f6e48716ebcc5ff92b3ebfb8399c8cd5e3b65e62d77e176abb6b44b0c2b", "bytes": 1641, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[4]#t0020", "version": null, "note": "Spleen protein species that differ in abundance by 2-ANOVA-Mouse in Col II immunized CD38 KO mice versus B6 WT mice.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 31, "column_count": 3}, "table": {"label": "Table 4", "caption": "Spleen protein species that differ in abundance by 2-ANOVA-Mouse in Col II immunized CD38 KO mice versus B6 WT mice.", "rows": [["DeCyder spot no.", "Protein namea", "Pvalue (2-ANOVA-Mouse)"], ["B6 WT:", "", ""], ["538", "Serotransferrin", "3.99E−04"], ["633", "Fibrinogen alpha chain", "6.11E−04"], ["692", "Fibrinogen beta chain", "1.12E−03"], ["1097", "ATP synthase subunit d, mitochondrial", "1.30E−03"], ["1302", "N-acyl-aromatic-L-amino acid", "1.75E−03"], ["", "amidohydrolase (carboxylate-forming)", ""], ["539", "Serotransferrin", "3.53E−03"], ["533", "Serotransferrin", "8.87E−03"], ["554", "Far upstream element-binding protein 1", "9.53E−03"], ["537", "Serotransferrin", "1.61E−02"], ["501", "Aconitate hydratase, mitochondrial", "1.78E−02"], ["1171", "Nucleoside diphosphate kinase A", "0.0195"], ["", "Nucleoside diphosphate kinase B", ""], ["1103", "Ferritin light chain 1", "2.06E−02"], ["", "Ferritin light chain 2", ""], ["1300", "Not identified", "0.023"], ["638", "Heterogeneous nuclear ribonucleoprotein L", "2.89E−02"], ["572", "Prelamin-A/C isoform A precursor (PMF)", "3.59E−02"], ["", "Prelamin-A/C isoform C (PMF)", ""], ["", "Fibroblast growth factor 22 (PMF)", ""], ["1313", "Protein S100-A8", "0.05"], ["CD38 KO:", "", ""], ["898", "Actin, cytoplasmic 2", "6.70E−03"], ["", "Beta-actin-like protein 2", ""], ["", "F-actin-capping protein subunit alpha-1", ""], ["982", "Carbonic anhydrase 2", "8.98E−03"], ["", "Carbonic anhydrase 1", ""], ["1044", "Not identified", "0.0202"], ["981", "Proteasome subunit alpha type-1", "2.39E−02"]], "row_count": 31, "column_count": 3, "numeric_cells": 53, "header_rows": 1, "locator": "section[5]/table-wrap[4]#t0020"}}, {"id": "asset:table:pmid:26909372:5", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:0750bb3743f3febb754c59c556936538a2a2b0ffa3d2a9994db07323b7b020a3", "bytes": 589, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[5]#t0025", "version": null, "note": "Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 10, "column_count": 3}, "table": {"label": "Table 5", "caption": "Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice.", "rows": [["DeCyder spot no.", "Protein namea", "Pvalue (2-ANOVA-Arthritis)"], ["In CIA+:", "", ""], ["438", "Not identified", "0.0162"], ["1150", "E3 ubiquitin-protein ligase RNF181", "0.0414"], ["", "", ""], ["In CIA−:", "", ""], ["1157", "Not identified", "0.021"], ["778", "Alpha-enolase", "0.0365"], ["", "Beta-enolase", ""], ["", "Gamma-enolase", ""]], "row_count": 10, "column_count": 3, "numeric_cells": 10, "header_rows": 1, "locator": "section[5]/table-wrap[5]#t0025"}}, {"id": "asset:table:pmid:26909372:6", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:0f4f2f58bac04e386601680951c8984b42767c9755bc29f64b042193e2b34536", "bytes": 1128, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[6]#t0030", "version": null, "note": "Spleen protein species that differ in abundance by 2-ANOVA-Interaction in two groups of Col.II-immunized mice (CD38 KO and B6 WT) with two conditions: CIA+ and CIA−).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 13, "column_count": 5}, "table": {"label": "Table 6", "caption": "Spleen protein species that differ in abundance by 2-ANOVA-Interaction in two groups of Col.II-immunized mice (CD38 KO and B6 WT) with two conditions: CIA+ and CIA−).", "rows": [["DeCyderspot no.", "Protein namea", "Pvalue(2-ANOVA-Mouse)", "Pvalue(2-ANOVA-Arthritis)", "Pvalue(2-ANOVA-Interaction)"], ["1302", "N-acyl-aromatic-L-amino acid", "1.75E−03", "0.535", "1.27E−04"], ["", "amidohydrolase (carboxylate-forming)", "", "", ""], ["532", "Not identified", "0.065", "0.585", "5.29E−04"], ["538", "Serotransferrin", "3.99E−04", "0.255", "8.40E−03"], ["982", "Carbonic anhydrase 2", "8.98E−03", "0.771", "8.99E−03"], ["", "Carbonic anhydrase 1", "", "", ""], ["1001", "Proteasome subunit alpha type-6", "0.878", "0.303", "9.65E−03"], ["", "Pyridoxine-5׳-phosphate oxidase", "", "", ""], ["983", "Mitochondrial peptide methionine", "0.545", "0.849", "3.57E−02"], ["", "sulfoxide reductase (PMF)", "", "", ""], ["1063", "Flavin reductase", "0.707", "0.779", "0.0362"], ["537", "Serotransferrin", "1.61E−02", "0.306", "4.07E−02"]], "row_count": 13, "column_count": 5, "numeric_cells": 39, "header_rows": 1, "locator": "section[5]/table-wrap[6]#t0030"}}, {"id": "asset:table:pmid:26909372:7", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:2c5bd0eaab35b70705aba495b1c47dbd696d962f832c276b2d8f82251b0e8f37", "bytes": 1849, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[7]#t0035", "version": null, "note": "Differences in spleen protein species abundance compared between Col II immunized CD38 KO mice (test group) versus Col II-immunized B6 WT mice (control group).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 31, "column_count": 4}, "table": {"label": "Table 7", "caption": "Differences in spleen protein species abundance compared between Col II immunized CD38 KO mice (test group) versus Col II-immunized B6 WT mice (control group).", "rows": [["DeCyder spot no.", "Protein namea", "Average ratiob", "Pvalue (t-test)"], ["", "", "Decreased abundance", ""], ["633", "Fibrinogen alpha chain", "−1.35", "1.67E−04"], ["692", "Fibrinogen beta chain", "−1.19", "4.53E−04"], ["1097", "ATP synthase subunit d, mitochondrial", "−1.25", "4.95E−04"], ["538", "Serotransferrin", "−1.23", "1.35E−03"], ["539", "Serotransferrin", "−1.29", "2.25E−03"], ["533", "Serotransferrin", "−1.39", "4.17E−03"], ["554", "Far upstream element-binding protein 1", "−1.17", "5.26E−03"], ["501", "Aconitate hydratase, mitochondrial", "−1.17", "9.81E−03"], ["1103", "Ferritin light chain 1", "−1.37", "0.0124"], ["", "Ferritin light chain 2", "", ""], ["638", "Heterogeneous nuclear ribonucleoprotein L", "−1.23", "0.0142"], ["537", "Serotransferrin", "−1.25", "0.0208"], ["572", "Prelamin-A/C isoform A precursor (MS)", "−1.18", "0.0209"], ["", "Prelamin-A/C isoform C (MS)", "", ""], ["", "Fibroblast growth factor 22 (MS)", "", ""], ["1171", "Nucleoside diphosphate kinase A", "−1.17", "0.0258"], ["", "Nucleoside diphosphate kinase B", "", ""], ["697", "Catalase", "−1.16", "0.0453"], ["536", "Not identified", "−1.14", "0.0475"], ["1300", "Not identified", "−1.33", "0.0493"], ["", "", "", ""], ["", "", "Increased abundance", ""], ["898", "Actin, cytoplasmic 2", "1.19", "4.37E−03"], ["", "Beta-actin-like protein 2", "", ""], ["", "F-actin-capping protein subunit alpha-1", "", ""], ["1044", "Not identified", "1.25", "0.0163"], ["981", "Proteasome subunit alpha type-1", "1.27", "0.0194"], ["982", "Carbonic anhydrase 2", "1.16", "0.0457"], ["", "Carbonic anhydrase 1", "", ""]], "row_count": 31, "column_count": 4, "numeric_cells": 70, "header_rows": 1, "locator": "section[5]/table-wrap[7]#t0035"}}, {"id": "asset:table:pmid:26909372:8", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:eb7eaecb2c3bf1c40d17af4b4997a86332897b3b08925021051edafc00ed4313", "bytes": 1068, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[8]#t0040", "version": null, "note": "Chronic inflammation model. Differences in spleen protein species abundance compared between CFA/IFA-treated CD38 KO mice (test group) and CFA/IFA-treated B6 WT mice (control group).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 15, "column_count": 4}, "table": {"label": "Table 8", "caption": "Chronic inflammation model. Differences in spleen protein species abundance compared between CFA/IFA-treated CD38 KO mice (test group) and CFA/IFA-treated B6 WT mice (control group).", "rows": [["DeCyder spot no.", "Protein namea", "Average ratiob", "P value (t-test)"], ["", "", "Decreased abundance", ""], ["1049", "Proteasome subunit beta type-10", "−1.18", "4.06E−03"], ["", "Growth factor receptor-bound protein 2", "", ""], ["1330", "Not identified", "−1.31", "0.0106"], ["972", "Tropomyosin alpha-1 chain", "−1.11", "0.0163"], ["1173", "Ubiquitin-conjugating enzyme E2 N", "−1.13", "0.0217"], ["1103", "Ferritin light chain 1", "−1.62", "0.0343"], ["", "Ferritin light chain 2", "", ""], ["738", "Vimentin", "−1.22", "0.0351"], ["1104", "Low molecular weight phosphotyrosine", "", ""], ["", "protein phosphatase (PMF)", "−1.28", "0.0384"], ["732", "Coronin-1", "−1.1", "0.0434"], ["", "", "Increased abundance", ""], ["1313", "Protein S100-A8", "1.37", "0.0236"]], "row_count": 15, "column_count": 4, "numeric_cells": 34, "header_rows": 1, "locator": "section[5]/table-wrap[8]#t0040"}}, {"id": "asset:table:pmid:26909372:9", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:34fc9b41e3eae819c79ef97a310209081b177a0365b3627bec371f704237a6f7", "bytes": 822, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[9]#t0045", "version": null, "note": "Non-immunized control mice. Differences in spleen protein species abundance compared between non-immunized CD38 KO mice (test group) and non-immunized B6 WT mice (control group).", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 10, "column_count": 4}, "table": {"label": "Table 9", "caption": "Non-immunized control mice. Differences in spleen protein species abundance compared between non-immunized CD38 KO mice (test group) and non-immunized B6 WT mice (control group).", "rows": [["DeCyder spot no.", "Protein namea", "Average ratiob", "Pvalue (t-test)"], ["", "", "Decreased abundance", ""], ["538", "Serotransferrin", "−1.26", "4.04E−03"], ["539", "Serotransferrin", "−1.23", "0.0185"], ["537", "Serotransferrin", "−1.22", "0.0221"], ["638", "Heterogeneous nuclear ribonucleoprotein L", "−1.13", "0.0266"], ["770", "Protein disulfide-isomerase A6", "−1.11", "0.0437"], ["532", "Not identified", "−1.2", "0.0477"], ["", "", "Increased abundance", ""], ["1295", "Not identified", "1.33", "0.0162"]], "row_count": 10, "column_count": 4, "numeric_cells": 21, "header_rows": 1, "locator": "section[5]/table-wrap[9]#t0045"}}, {"id": "asset:table:pmid:26909372:10", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:a2bdd4109b56a310171ca7bb2268fec7a5ab960352ddfc73613b7c8a8f06c6b8", "bytes": 1967, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[10]#t0050", "version": null, "note": "Citrullinated protein species and peptidesa detected in spleen from collagen-induced arthritis, or CFA-treated mice. TOF/TOF 4800.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 16, "column_count": 11}, "table": {"label": "Table 10a", "caption": "Citrullinated protein species and peptidesa detected in spleen from collagen-induced arthritis, or CFA-treated mice. TOF/TOF 4800.", "rows": [["Spot number", "Identification", "Accesion", "Accension number", "Protein score", "Protein score CI%", "Pep. count", "Total ion score", "Total % ion CI", "MW (theoretical)", "IEP (theoretical)"], [""], ["537", "Serotransferrin", "TRFE_MOUSE", "Q921I1", "172", "100", "20", "107", "100.00", "78840.50", "6.94"], ["614", "Stress-induced-phosphoprotein 1", "STIP1_MOUSE", "Q60864", "238", "100", "27", "145", "100.00", "63169.60", "6.40"], ["697", "Catalase", "CATA_MOUSE", "Q8C6E3", "174", "100", "15", "131", "100.00", "60082.80", "7.73"], ["778", "Alpha enolase", "ENOA_MOUSE", "P17182", "940", "100", "33", "675", "100.00", "47453.30", "6.37"], ["", "Beta enolase", "ENOB_MOUSE", "P21550", "260", "100", "12", "224", "100.00", "47337.40", "6.73"], ["", "Gamma enolase", "ENOG_MOUSE", "P17183", "102", "100", "10", "75", "100.00", "47609.10", "4.99"], ["981", "Proteasome subunit alpha type-1", "PSA1_MOUSE", "Q9R1P4", "415", "100", "14", "350", "100.00", "29812.90", "6.00"], ["", "Proteasome subunit alpha type", "PSMA1_MOUSE", "Q8BTU5", "399", "100", "12", "349", "100.00", "29732.80", "5.78"], ["1001", "Proteasome subunit alpha type-6", "PSA6_MOUSE", "Q9QUM9", "325", "100", "13", "264", "100.00", "27811.00", "6.34"], ["", "Pyridoxine-5׳-phosphate oxidase", "PNPO_MOUSE", "Q91XF0", "81", "99.999", "5", "57", "100.00", "30437.10", "8.46"], ["1103", "Ferritin light chain 2", "FRIL2_MOUSE", "P49945", "251", "100", "10", "202", "100.00", "20886.90", "6.39"], ["1136", "Peptidyl-prolyl cis–trans isomerase A", "PPIA_MOUSE", "P17742", "320", "100", "11", "249", "100.00", "18130.90", "7.74"], ["1171", "Nucleoside diphosphate kinase A", "NDKA_MOUSE", "P15532", "726", "100", "17", "591", "100.00", "17310.90", "6.84"], ["", "Nucleoside diphosphate kinase B", "NDKB_MOUSE", "Q01768", "321", "100", "9", "278", "100.00", "17466.00", "6.97"]], "row_count": 16, "column_count": 11, "numeric_cells": 122, "header_rows": 0, "locator": "section[5]/table-wrap[10]#t0050"}}, {"id": "asset:table:pmid:26909372:11", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:f13552d9a447325194dcc14712924fda4d8c1ba2225f5fe871d88b51854a9036", "bytes": 863, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[11]#t0100", "version": null, "note": "Citrullinated protein species and peptidesa detected in spleen from collagen-induced arthritis, or CFA-treated mice. TOF/TOF UltrafleXtreme.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 6, "column_count": 10}, "table": {"label": "Table 10b", "caption": "Citrullinated protein species and peptidesa detected in spleen from collagen-induced arthritis, or CFA-treated mice. TOF/TOF UltrafleXtreme.", "rows": [["Spot number", "Protein name", "Accession", "Accesion number", "MW (theoretical)", "IEP (theoretical)", "Score", "Sequence coverage (%)", "Queries matched", "Queries searched"], [""], ["633", "Fibrinogen alpha chain", "FIBA_MOUSE", "E9PV24", "87.40", "5.78", "101.00", "17.00", "15", "26"], ["732", "Coronin-1A", "COR1A_MOUSE", "O89053", "51.00", "6.04", "83.40", "36.00", "16", "75"], ["898", "F-actin-capping protein subunit alpha-1", "CAZA1_MOUSE", "P47753", "32.90", "5.34", "77.90", "43.00", "12", "65"], ["972", "Tropomyosin alpha-3 chain", "TPM3_MOUSE", "P21107", "33.00", "4.68", "60.50", "38.60", "10", "40"]], "row_count": 6, "column_count": 10, "numeric_cells": 35, "header_rows": 0, "locator": "section[5]/table-wrap[11]#t0100"}}, {"id": "asset:table:pmid:26909372:12", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:585601e128fad84ea3a9d17da5b24beac428a81fbda7481c66fa80706438b246", "bytes": 1884, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[12]#t0055", "version": null, "note": "Detected peptides in a tryptic digest of standard mTf analyzed by µLC–MS–TOF.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 81, "column_count": 2}, "table": {"label": "Table 11", "caption": "Detected peptides in a tryptic digest of standard mTf analyzed by µLC–MS–TOF.", "rows": [["Detected peptides in mTf standard"], ["VPDK", "✓"], ["TVK", "✓"], ["WCAVSEHENTK", "✓"], ["CISFR", "✓"], ["DHMK", "✓"], ["TVLPPDGPR", "✓"], ["LACVK", "✓"], ["K", "✓"], ["TSYPDCIK", "✓"], ["AISASEADAMTLDGGWVYDA GLTPNNLKPVAAEFYGSVEH PQTYYYAVAVVK", "X"], ["K", "✓"], ["GTDFQLNQLEGK", "✓"], ["K", "✓"], ["SCHTGLGR", "✓"], ["SAGWVIPIGLLFCK", "✓"], ["LSEPR", "✓"], ["SPLEK", "✓"], ["AVSSFFSGSCVPCADPVAFP K", "✓"], ["LCQLCPGCGCSSTQPFFGYV GAFK", "✓"], ["CLK", "✓"], ["DGGGDVAFVK", "✓"], ["HTTIFEVLPEK", "✓"], ["ADR", "✓"], ["DQYELLCLDNTR", "✓"], ["KPVDQYEDCYLAR", "✓"], ["IPSHAVVAR", "✓"], ["K", "✓"], ["NNGK", "X"], ["EDLIWEILK", "✓"], ["VAQEHFGK", "✓"], ["GK", "✓"], ["SK", "✓"], ["DFQLFSSPLGK", "✓"], ["DLLFK", "✓"], ["DSAFGLLR", "✓"], ["VPPR", "✓"], ["MDYR", "✓"], ["LYLGHNYVTAIR", "✓"], ["NQQEGVCPEGSIDNSPVK", "✓"], ["WCALSHLER", "✓"], ["TK", "✓"], ["CDEWSIISEGK", "✓"], ["IECESAETTEDCIEK", "✓"], ["IVNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPK", "✓"], ["GYYAVAVVK", "✓"], ["ASDTSITWNNLK", "✓"], ["GK", "✓"], ["K", "✓"], ["SCHTGVDR", "✓"], ["TAGWNIPMGMLYNR", "✓"], ["INHCK", "✓"], ["FDEFFSQGCAPGYEK", "✓"], ["CAPNNK", "✓"], ["EEYNGYTGAFR", "✓"], ["CLVEK", "✓"], ["GDVAFVK", "✓"], ["HQTVLDNTEGK", "✓"], ["NPAEWAK", "✓"], ["NLK", "✓"], ["QEDFELLCPDGTR", "✓"], ["KPVK", "✓"], ["DFASCHLAQAPNHVVVSR", "✓"], ["K", "✓"], ["EK", "✓"], ["AAR", "✓"], ["VK", "✓"], ["AVLTSQETLFGGSDCTGNFC LFK", "✓"], ["STTK", "✓"], ["DLLFR", "✓"], ["DDTK", "X"], ["CFVK", "✓"], ["LPEGTTPEK", "✓"], ["YLGAEYMQSVGNMR", "✓"], ["K", "✓"], ["CSTSR", "✓"], ["LLEACTFHK", "✓"], ["H", "✓"], ["Total number of amino acids", "678"], ["Number of amino acids detected", "618"], ["Coverage (%)", "91"]], "row_count": 81, "column_count": 2, "numeric_cells": 3, "header_rows": 1, "locator": "section[5]/table-wrap[12]#t0055"}}, {"id": "asset:table:pmid:26909372:13", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:128c61079258d4bf747bfb4553f144a9fc24837e033509be46a38af2b3cfa18a", "bytes": 985, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[13]#t0060", "version": null, "note": "Normalized peak area and %RSD of Tf glycopeptide glycoforms detected in the spots of spleen protein extracts subjected to 2D electrophoretic separation and in-gel tryptic digestion.", "structure": {"pmcid": "PMC4731419", "section_index": 5, "section_title": "Data", "row_count": 8, "column_count": 11}, "table": {"label": "Table 12", "caption": "Normalized peak area and %RSD of Tf glycopeptide glycoforms detected in the spots of spleen protein extracts subjected to 2D electrophoretic separation and in-gel tryptic digestion.", "rows": [["Glycoforms", "Spot 532", "Spot 533", "Spot 536", "Spot 537", "Spot 539"], ["Anorm⁎", "%RSD", "Anorm⁎", "%RSD", "Anorm⁎", "%RSD", "Anorm⁎⁎", "%RSD", "Anorm⁎", "%RSD"], ["2Ant/1NeuGc", "7.7", "6.1", "–", "–", "–", "–", "17.0", "18.1", "15.4", "6.4"], ["2Ant/1NeuGc1Fuc", "5.5", "1.2", "–", "–", "–", "–", "–", "–", "–", "–"], ["2Ant/2NeuGc", "54.7", "3.7", "56.9", "7.1", "54.9", "7.9", "76.5", "5.5", "137.8", "0.8"], ["2Ant/2NeuGc1Fuc", "29.8", "6.7", "25.9", "7.5", "–", "–", "16.2", "20.7", "26.1", "17.1"], ["2Ant/3NeuGc", "17.7", "5.5", "–", "–", "–", "–", "29.8", "15.6", "8.7", "4.9"], ["2Ant/3NeuGc1Fuc", "2.6", "3.3", "–", "–", "–", "–", "–", "–", "–", "–"]], "row_count": 8, "column_count": 11, "numeric_cells": 45, "header_rows": 2, "locator": "section[5]/table-wrap[13]#t0060"}}], "gaps": []}, "analysis": {"state": "complete", "methods": [{"id": "method-1", "family": "group_comparison", "specific": "anova", "label": "Group comparison", "dsl_operations": ["group_summary", "welch_t", "bootstrap_mean_difference", "group_comparison_anova"], "missing_operations": [], "expressible": true, "parameters": {}, "data_shapes": ["two_or_more_groups_continuous"], "evidence": {"score": 1.0, "band": "verbatim", "quote": "Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice."}}], "targets": [], "gaps": []}, "capability": {"state": "complete", "requirements": [{"capability_id": "capability:computational_analysis", "label": "Computational analysis platform", "assay_families": ["meta_analysis", "machine_learning", "survival_analysis", "statistical_regression", "pca", "molecular_docking", "network_analysis", "differential_expression", "gwas"], "availability_state": "owned", "tier_unlocked": "R1", "candidate": "Automated Assays Laravel application and simulated adapters"}], "gaps": []}, "readiness": {"state": "blocked", "tier": "R4", "blocking_axis": "data", "blocked_on": "data:accession_absent", "axes": {"method": {"tier": "R1", "expressible": true, "required_operations": ["group_summary", "welch_t", "bootstrap_mean_difference", "group_comparison_anova"], "missing_operations": [], "basis": "The paper names the method it used and the corpus's method extractor maps it onto the DSL catalogue: anova."}, "capability": {"tier": "R1", "capability_id": "capability:computational_analysis", "availability_state": "owned", "basis": "The computational analysis is owned. The physical bench the paper used is not, so a physical validation cannot be run here."}, "data": {"tier": "R4", "reachable": false, "accessions": ["PRIDE: PXD002644", "PRIDE: PXD002643", "PRIDE: PXD003183", "PRIDE: PXD003163"], "resolved_accessions": [], "statements": ["Data is within this article. Data also available at the ProteomeXchange Consortium via the PRIDE partner repository, PRIDE: PXD002644, PRIDE: PXD002643, PRIDE: PXD003183 and PRIDE: PXD003163."], "basis": "The paper names PRIDE: PXD002644, PRIDE: PXD002643, PRIDE: PXD003183, PRIDE: PXD003163, but the accession does not resolve in the repository (no reason recorded, no reason recorded, no reason recorded, no reason recorded), so the data cannot be reached from here. No dataset was downloaded and no licence was read."}}, "can_run": {"dsl_operations": ["group_summary", "welch_t", "bootstrap_mean_difference", "group_comparison_anova"], "assets": ["source:pmid:26909372", "asset:table:pmid:26909372:1", "asset:table:pmid:26909372:2", "asset:table:pmid:26909372:3", "asset:table:pmid:26909372:4", "asset:table:pmid:26909372:5", "asset:table:pmid:26909372:6", "asset:table:pmid:26909372:7", "asset:table:pmid:26909372:8", "asset:table:pmid:26909372:9", "asset:table:pmid:26909372:10", "asset:table:pmid:26909372:11", "asset:table:pmid:26909372:12", "asset:table:pmid:26909372:13"], "steps": ["run_analysis"]}, "must_build": {"dsl_operations": [], "converters": [], "readers": [], "capabilities": [], "data_gaps": ["data:geo:None"]}, "gaps": ["data:accession_absent"]}, "review": {"state": "partial", "machine_critique": {"kind": "extraction_review", "reader": {"model": "MiniMax-M3.1-Flash", "provider": "minimax", "provider_family": "minimax", "read_at": "2026-10-31T18:27:17Z", "independence": "same_provider"}, "evidence_check": {"method": "verbatim", "availability": "verbatim"}, "calls": 8, "usage": {"prompt_tokens": 50370, "completion_tokens": 4690, "cached_tokens": 7612}}, "human_critique": null, "stages": [{"id": "extraction", "state": "complete", "reader": "MiniMax-M3.1-Flash", "provider": "minimax"}], "gaps": ["review.independent_reader", "review.machine_critique", "review.human_critique"]}, "execution": {"state": "absent", "status": "not_run", "mode": null, "runs": [], "gaps": ["execution.not_run"]}, "provenance": {"entities": [{"id": "pmid:26909372", "type": "paper", "label": "pmid:26909372"}, {"id": "source:pmid:26909372", "type": "manuscript", "label": "PMID 26909372 full text"}, {"id": "data:geo:None", "type": "dataset", "label": "GEO None"}], "activities": [{"id": "activity-reading-sci-2026-11-01", "type": "classification", "used": [{"id": "pmid:26909372", "type": "paper", "label": "pmid:26909372"}, {"id": "source:pmid:26909372", "type": "manuscript", "label": "PMID 26909372 full text"}, {"id": "data:geo:None", "type": "dataset", "label": "GEO None"}], "agent": "agent:corpus-assay-engine"}, {"id": "activity-read-26909372", "type": "extraction", "used": ["source:pmid:26909372"], "agent": "agent:minimax-reader"}, {"id": "activity-resolve-None", "type": "accession_resolution", "used": ["data:geo:None"], "agent": "agent:corpus-assay-engine"}], "agents": [{"id": "agent:corpus-assay-engine", "type": "software", "label": "Corpus assay engine"}, {"id": "agent:minimax-reader", "type": "software", "label": "MiniMax literature reader"}], "source_run_id": "reading-sci-2026-11-01", "dsl_catalogue_fingerprint": "343fb30756ba6ec3", "capability_table_fingerprint": "2cb3e42f047d2ecf", "snapshot_id": "ba34b49490d9bfaf"}, "lineage": {"parent_id": "pmid:26909372", "parent_hash": "sha256:5cda6003b20693e547a65a1c5e1043b4bf696c58681584d1d4661a938b63f01f", "fork_of": null, "generation": 7}, "gaps": ["execution.not_run", "review.human_critique", "review.independent_reader", "review.machine_critique", "step:obtain_source_data blocked on data:accession_absent"], "assays": [{"role": "data_generation", "definition_id": "mass_spectrometry", "definition_version": "99e1195c7d6f", "definition_digest": null, "required_operations": [], "support_state": "partial", "source_hashes": {"assay_lexicon": "99e1195c7d6f"}, "confidence": 0.93, "evidence": ["disease activity: the role of CD38\" [1]. All mass spectrometry data have been deposited to the ProteomeXcha"], "order_basis": "paper_text_order:1381", "id": "assay:1"}, {"role": "analysis", "definition_id": "group_comparison", "definition_version": "f2132e96ae6c7a4e", "definition_digest": null, "required_operations": ["group_summary", "welch_t", "bootstrap_mean_difference", "group_comparison_anova"], "support_state": "supported", "source_hashes": {"dsl_catalogue": "f2132e96ae6c7a4e"}, "confidence": 1.0, "evidence": ["Spleen protein species that differ in abundance by 2-ANOVA-Arthritis test in Col II-immunized CIA+ versus CIA− mice."], "order_basis": "consumes_earlier_output", "id": "assay:2"}]}