Glycoproteomic Profiling Provides Candidate Myocardial Infarction Predictors of Later Progression to Heart Failure.

{"sci_version": "1.2", "schema": "https://corpus.bntrg.co.uk/sci/1.0/sci.schema.json", "id": "pmid:30729226", "kind": "science-record", "revision": 6, "content_hash": "sha256:7e9b89c37e0d805bd0b6cfcd88d6214c635b7190b6446deedcfb6fed08bc6d47", "created_at": "2026-11-01T15:40:42Z", "updated_at": "2026-11-01T21:21:59Z", "generator": {"name": "corpus-assay-engine", "run_id": "reading-sci-2026-11-01"}, "paper": {"state": "complete", "title": "Glycoproteomic Profiling Provides Candidate Myocardial Infarction Predictors of Later Progression to Heart Failure.", "doi": "10.1021/acsomega.8b02207", "pmid": "30729226", "authors": ["Kristine Y Deleon-Pennell", "Osasere K Ero", "Yonggang Ma", "Rugmani Padmanabhan Iyer", "Elizabeth R Flynn", "Ingrid Espinoza", "Solomon K Musani", "Ramachandran S Vasan", "Michael E Hall", "Ervin R Fox", "Merry L Lindsey"], "journal": "ACS omega", "year": 2019, "abstract": "We hypothesized that identifying plasma glycoproteins that predict the development of heart failure following myocardial infarction (MI) could help to stratify subjects at risk. Plasma collected at visit 2 (2005-2008) from an MI subset of Jackson Heart Study participants underwent glycoproteomics and was grouped by the outcome: (1) heart failure hospitalization after visit 2 (n = 15) and (2) without hospitalization by 2012 (n = 45). Proteins were mapped for biological processes and functional pathways using Ingenuity Pathway Analysis and linked to clinical characteristics. A total of 198 glycopeptides corresponding to 88 proteins were identified (data available via ProteomeXchange with identifier PXD009870). Of these, 14 glycopeptides were significantly different between MI and MI + HF groups and corresponded to apolipoprotein (Apo) F, transthyretin, Apo C-IV, prostaglandin-D2 synthase, complement C9, and CD59 (p < 0.05 for all). All proteins were elevated in the MI + HF group, except CD59, which was lower. Four canonical pathways were upregulated in the MI + HF group (p < 0.05 for all): acute phase response, liver X receptor/retinoid X receptor, and macrophage reactive oxygen species generation. The coagulation pathway was significantly downregulated in the MI + HF group (p < 0.05). Even after adjustment for age and sex, Apo F was associated with the increased risk for heart failure (OR = 21.84; 95% CI 3.20-149.14). In conclusion, glycoproteomic profiling provided candidate early MI predictors of later progression to heart failure.", "claims": [{"id": "claim-method", "statement": "Logistic regression analyses were used to evaluate associations between plasma glycoprotein markers and HF development after MI in univariate and multivariable models, adjusting for age, sex, and time between MI and plasma collection.", "kind": "methodological", "target": null, "evidence": [{"asset": "source:pmid:30729226", "locator": "sections[12] \"Statistics and Bioinformatics\" paragraph 3", "quote": "Logistic regression analyses were used to evaluate associations between plasma glycoprotein markers and HF development after MI in univariate and multivariable models, adjusting for age, sex, and time between MI and plasma collection."}], "state": "complete"}, {"id": "claim-data-access", "statement": "data available via ProteomeXchange with identifier PXD009870", "kind": "methodological", "target": null, "evidence": [{"asset": "source:pmid:30729226", "locator": "sections[0] \"Abstract\" paragraph 1", "quote": "data available via ProteomeXchange with identifier PXD009870"}], "state": "complete"}], "gaps": []}, "experiment": {"state": "complete", "objective": null, "steps": [{"id": "read_published_estimate", "order": 1, "name": "Read the published estimate from the source", "kind": "other", "state": "complete", "blocked_on": null, "description": "The claim, method and evidence span published with the source article.", "duration_hours": null, "parameters": {}, "inputs": ["source:pmid:30729226"], "outputs": ["the published estimate and its evidence"], "instruments": [], "reagents": []}, {"id": "obtain_source_data", "order": 2, "name": "Obtain the source data from the named repository", "kind": "data-preparation", "state": "complete", "blocked_on": null, "description": "The GEO series accession resolves and its sample accessions are listed. This lane did not download the dataset or read its licence.", "duration_hours": null, "parameters": {}, "inputs": ["data:geo:PXD009870"], "outputs": ["the source data with its repository provenance"], "instruments": [], "reagents": []}, {"id": "run_analysis", "order": 3, "name": "Run the published analysis", "kind": "analysis", "state": "complete", "blocked_on": null, "description": "Apply the paper's statistical method to the resolved series and compare the result with the published target.", "duration_hours": null, "parameters": {}, "inputs": ["data:geo:PXD009870"], "outputs": ["the replicated result and its comparison"], "instruments": [], "reagents": []}], "materials": [], "instruments": [], "reagents": [], "conditions": {}, "gaps": []}, "data": {"state": "partial", "assets": [{"id": "source:pmid:30729226", "role": "manuscript", "format": "xml", "media_type": "application/xml", "uri": "https://doi.org/10.1021/acsomega.8b02207", "sha256": "sha256:2a80d16c5b98a65beca21a296797269a9a2315a3f9f35580f77f91acd901f212", "bytes": 28723, "access": "open", "state": "resolved", "reader": null, "reader_status": "reader_required", "identifier": "10.1021/acsomega.8b02207", "version": null, "note": "Full article fetched from PMC; the checksum covers the rendered section body, not the original XML bytes.", "structure": {"pmcid": "PMC6356850", "source": "europe_pmc_fulltext", "coverage": "whole_body_without_references", "text_hash_scope": "rendered_section_body"}}, {"id": "data:geo:PXD009870", "role": "raw", "format": "geo-series", "media_type": "application/vnd.ncbi.geo-series+json", "uri": "https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=PXD009870", "sha256": null, "bytes": null, "access": "open", "state": "resolved", "reader": null, "reader_status": "reader_required", "identifier": "PXD009870", "version": null, "note": "data available via ProteomeXchange with identifier PXD009870", "structure": {"repository": "GEO", "access_route": "GEO accession URL", "access_statement_verbatim": "data available via ProteomeXchange with identifier PXD009870", "access_statement_kind": "data_availability_statement", "sample_accessions": [], "sample_count": null, "group_sizes": null, "group_sizes_basis": null, "platform": null, "taxon": null, "title": "Proteomics of JHS samples identifies proteins associated with heart failure", "resolution_checked_at": "2026-10-31T18:35:55Z", "resolution_check": "identifier_resolution_only_no_download_no_licence_read", "downloaded": false, "licence_read": false}}, {"id": "asset:table:pmid:30729226:1", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:ba093801242c3dd136b951af26b36e279bc164db07bbe9c058fdd8558b2c025c", "bytes": 1366, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[3]/table-wrap[1]#tbl1", "version": null, "note": "Clinical Characteristics in Groups Divided by Post-MI Congestive HF Statusa,b", "structure": {"pmcid": "PMC6356850", "section_index": 3, "section_title": "Glycoproteomic Analysis Identified 198 Peptides Belonging to 88 Unique Glycoproteins (Table S2)", "row_count": 20, "column_count": 4}, "table": {"label": "Table 1", "caption": "Clinical Characteristics in Groups Divided by Post-MI Congestive HF Statusa,b", "rows": [["", "MI (n = 45)", "MI + HF (n = 15)", "p value"], ["age (years)", "69 ± 9", "70 ± 10", "0.617"], ["sex, men/women (% women)", "24/21 (47%)", "3/12 (80%)", "0.036"], ["beta blocker (%)", "23 (51%)", "10 (64%)", "0.060"], ["body mass index (kg/m2)", "28.9 ± 4.3", "34.8 ± 9.5", "0.060"], ["calcium channel blocker (%)", "12 (27%)", "2 (13%)", "0.397"], ["diabetes history", "17 (38%)", "12 (80%)", "0.022"], ["diuretic (%)", "23 (51%)", "9 (60%)", "0.199"], ["diastolic blood pressure (mmHg)", "74 ± 1", "71 ± 3", "0.545"], ["fasting glucose (mg/dL)", "108 ± 7", "112 ± 14", "0.808"], ["fasting HDL (mg/dL)", "52 ± 3", "64 ± 12", "0.106"], ["fasting LDL (mg/dL)", "102 ± 7", "103 ± 15", "0.977"], ["fasting triglycerides (mg/dL)", "100 ± 9", "189 ± 80", "0.300"], ["hemoglobin A1C (%)", "6.1 ± 0.1", "7.7 ± 0.5", "0.008"], ["prevalent chronic kidney disease (%)", "0 (0%)", "1 (7%)", "0.083"], ["smokers (%)", "7 (16%)", "3 (20%)", "0.721"], ["statin use (%)", "15 (33%)", "2 (13%)", "0.683"], ["systolic blood pressure (mmHg)", "134 ± 3", "138 ± 7", "0.500"], ["time between MI and visit 2 (yrs)", "6 ± 5", "5 ± 5", "0.760"], ["QTc interval (ms; from visit 3)", "437 ± 32", "437 ± 60", "0.968"]], "row_count": 20, "column_count": 4, "numeric_cells": 61, "header_rows": 1, "locator": "section[3]/table-wrap[1]#tbl1"}}, {"id": "asset:table:pmid:30729226:2", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:6013489f49a955c78a599762070649b798422e1c366a87176b23fb0a5da93ecc", "bytes": 548, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[3]/table-wrap[2]#tbl2", "version": null, "note": "Proteins Differentially Expressed in MI + HF Subjects (all p < 0.05)a", "structure": {"pmcid": "PMC6356850", "section_index": 3, "section_title": "Glycoproteomic Analysis Identified 198 Peptides Belonging to 88 Unique Glycoproteins (Table S2)", "row_count": 7, "column_count": 4}, "table": {"label": "Table 2", "caption": "Proteins Differentially Expressed in MI + HF Subjects (all p < 0.05)a", "rows": [["accession #", "protein name", "MI + HF/MI ratio", "p value"], ["4502165", "Apo F", "2.503", "0.001"], ["4507725", "transthyretin", "2.382", "0.014"], ["4502161", "Apo C4", "1.667", "0.014"], ["32171249", "prostaglandin-H2 D-isomerase", "3.070", "0.017"], ["4502511", "complement C9", "1.416", "0.031"], ["42761474", "CD59 glycoprotein", "0.521", "0.043"]], "row_count": 7, "column_count": 4, "numeric_cells": 19, "header_rows": 1, "locator": "section[3]/table-wrap[2]#tbl2"}}, {"id": "asset:table:pmid:30729226:3", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:74451e4682aa3a132a2386c37af2d384c9eb484108c53c0052ffbca077346196", "bytes": 965, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[3]/table-wrap[3]#tbl3", "version": null, "note": "Peptides from Three Proteins were Differentially Expressed at the Individual Peptide but Not Whole Protein Level", "structure": {"pmcid": "PMC6356850", "section_index": 3, "section_title": "Glycoproteomic Analysis Identified 198 Peptides Belonging to 88 Unique Glycoproteins (Table S2)", "row_count": 13, "column_count": 5}, "table": {"label": "Table 3", "caption": "Peptides from Three Proteins were Differentially Expressed at the Individual Peptide but Not Whole Protein Level", "rows": [["accession #", "protein", "peptide sequence", "MI + HF/MI ratio", "p value"], ["115298678", "complement C3", "DAPDHQELNLDVSLQLPSR", "1.42", "0.019"], ["", "", "VHQYFNVELIQPGAVK", "1.83", "0.026"], ["", "", "VELLHNPAFCSLATTK", "1.68", "0.045"], ["", "", "all peptides combined", "0.99", "0.949"], ["73858566", "heparin cofactor 2", "GGETAQSADPQWEQLNNKNLSMPLLPADFHK", "1.75", "0.002"], ["", "", "GETHEQVHSILHFKDFVNASSK", "1.16", "0.359"], ["", "", "DFVNASSK", "1.05", "0.757"], ["", "", "NLSMPLLPADFHK", "1.00", "0.974"], ["", "", "all peptides combined", "1.17", "0.161"], ["31377806", "polymeric immunoglobulin receptor", "VPGNVTAVLGETLK", "1.79", "0.006"], ["", "", "ANLTNFPENGTFVVNIAQLSQDDSGR", "1.49", "0.254"], ["", "", "all peptides combined", "1.43", "0.057"]], "row_count": 13, "column_count": 5, "numeric_cells": 28, "header_rows": 1, "locator": "section[3]/table-wrap[3]#tbl3"}}, {"id": "asset:table:pmid:30729226:4", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:ed37e9a0a8ed22b0fd13227a8e2a146e67396dc79692ae7afe33e84240a09230", "bytes": 412, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[3]/table-wrap[4]#tbl4", "version": null, "note": "Disease Associationsa", "structure": {"pmcid": "PMC6356850", "section_index": 3, "section_title": "Glycoproteomic Analysis Identified 198 Peptides Belonging to 88 Unique Glycoproteins (Table S2)", "row_count": 3, "column_count": 6}, "table": {"label": "Table 4", "caption": "Disease Associationsa", "rows": [["name", "p value", "adjusted p value", "Z-score", "combined score", "proteins"], ["complement deficiency", "1.80 × 10–8", "3.60 × 10–8", "–1.32", "23.63", "CD59, C3, C9"], ["macular degeneration", "0.00807", "0.00807", "–1.44", "6.96", "C3, Apo F"]], "row_count": 3, "column_count": 6, "numeric_cells": 9, "header_rows": 1, "locator": "section[3]/table-wrap[4]#tbl4"}}], "gaps": ["asset:data:geo:PXD009870 not downloaded", "asset:data:geo:PXD009870 licence not read"]}, "analysis": {"state": "complete", "methods": [{"id": "method-1", "family": "regression_modelling", "specific": "logistic", "label": "Regression modelling", "dsl_operations": ["glm_logit_fit"], "missing_operations": [], "expressible": true, "parameters": {}, "data_shapes": ["predictors_and_outcome"], "evidence": {"score": 1.0, "band": "verbatim", "quote": "Logistic regression analyses were used to evaluate associations between plasma glycoprotein markers and HF development after MI in univariate and multivariable models, adjusting for age, sex, and time between MI and plasma collection."}}], "targets": [], "gaps": []}, "capability": {"state": "complete", "requirements": [{"capability_id": "capability:computational_analysis", "label": "Computational analysis platform", "assay_families": ["meta_analysis", "machine_learning", "survival_analysis", "statistical_regression", "pca", "molecular_docking", "network_analysis", "differential_expression", "gwas"], "availability_state": "owned", "tier_unlocked": "R1", "candidate": "Automated Assays Laravel application and simulated adapters"}], "gaps": []}, "readiness": {"state": "complete", "tier": "R1", "blocking_axis": "none", "blocked_on": "nothing:replicable_now", "axes": {"method": {"tier": "R1", "expressible": true, "required_operations": ["glm_logit_fit"], "missing_operations": [], "basis": "The paper names the method it used and the corpus's method extractor maps it onto the DSL catalogue: logistic."}, "capability": {"tier": "R1", "capability_id": "capability:computational_analysis", "availability_state": "owned", "basis": "The computational analysis is owned. The physical bench the paper used is not, so a physical validation cannot be run here."}, "data": {"tier": "R1", "reachable": true, "accessions": ["PXD009870"], "resolved_accessions": ["PXD009870"], "statements": ["data available via ProteomeXchange with identifier PXD009870"], "basis": "The paper names PXD009870 in ProteomeXchange Consortium via the PRIDE partner repository and the accession resolves in the repository. No dataset was downloaded and no licence was read."}}, "can_run": {"dsl_operations": ["glm_logit_fit"], "assets": ["source:pmid:30729226", "data:geo:PXD009870", "asset:table:pmid:30729226:1", "asset:table:pmid:30729226:2", "asset:table:pmid:30729226:3", "asset:table:pmid:30729226:4"], "steps": ["run_analysis"]}, "must_build": {"dsl_operations": [], "converters": [], "readers": [], "capabilities": [], "data_gaps": ["data:geo:PXD009870"]}, "gaps": []}, "review": {"state": "partial", "machine_critique": {"kind": "extraction_review", "reader": {"model": "MiniMax-M3.1-Flash", "provider": "minimax", "provider_family": "minimax", "read_at": "2026-10-31T18:13:49Z", "independence": "single_reader"}, "evidence_check": {"method": "verbatim", "availability": "verbatim"}, "calls": 3, "usage": {"prompt_tokens": 20753, "completion_tokens": 1661, "cached_tokens": 784}}, "human_critique": null, "stages": [{"id": "extraction", "state": "complete", "reader": "MiniMax-M3.1-Flash", "provider": "minimax"}], "gaps": ["review.independent_reader", "review.machine_critique", "review.human_critique"]}, "execution": {"state": "absent", "status": "not_run", "mode": null, "runs": [], "gaps": ["execution.not_run"]}, "provenance": {"entities": [{"id": "pmid:30729226", "type": "paper", "label": "pmid:30729226"}, {"id": "source:pmid:30729226", "type": "manuscript", "label": "PMID 30729226 full text"}, {"id": "data:geo:PXD009870", "type": "dataset", "label": "GEO PXD009870"}], "activities": [{"id": "activity-reading-sci-2026-11-01", "type": "classification", "used": [{"id": "pmid:30729226", "type": "paper", "label": "pmid:30729226"}, {"id": "source:pmid:30729226", "type": "manuscript", "label": "PMID 30729226 full text"}, {"id": "data:geo:PXD009870", "type": "dataset", "label": "GEO PXD009870"}], "agent": "agent:corpus-assay-engine"}, {"id": "activity-read-30729226", "type": "extraction", "used": ["source:pmid:30729226"], "agent": "agent:minimax-reader"}, {"id": "activity-resolve-PXD009870", "type": "accession_resolution", "used": ["data:geo:PXD009870"], "agent": "agent:corpus-assay-engine"}], "agents": [{"id": "agent:corpus-assay-engine", "type": "software", "label": "Corpus assay engine"}, {"id": "agent:minimax-reader", "type": "software", "label": "MiniMax literature reader"}], "source_run_id": "reading-sci-2026-11-01", "dsl_catalogue_fingerprint": "343fb30756ba6ec3", "capability_table_fingerprint": "2cb3e42f047d2ecf", "snapshot_id": "ba34b49490d9bfaf"}, "lineage": {"parent_id": "pmid:30729226", "parent_hash": "sha256:14b3dda85b3e9bb1d545d2c8928b9408041af9496150e71cb4cef4a39f32099c", "fork_of": null, "generation": 5}, "gaps": ["asset:data:geo:PXD009870 licence not read", "asset:data:geo:PXD009870 not downloaded", "execution.not_run", "review.human_critique", "review.independent_reader", "review.machine_critique"], "assays": [{"role": "analysis", "definition_id": "regression_modelling", "definition_version": "f2132e96ae6c7a4e", "definition_digest": null, "required_operations": ["glm_logit_fit"], "support_state": "supported", "source_hashes": {"dsl_catalogue": "f2132e96ae6c7a4e"}, "confidence": 1.0, "evidence": ["Logistic regression analyses were used to evaluate associations between plasma glycoprotein markers and HF development after MI in univariate and multivariable models, adjusting for age, sex, and time between MI and plasma collection."], "order_basis": "analysis_only", "id": "assay:1"}]}