A High Resolution Mass Spectrometry Study Reveals the Potential of Disulfide Formation in Human Mitochondrial Voltage-Dependent Anion Selective Channel Isoforms (hVDACs).

{"sci_version": "1.2", "schema": "https://corpus.bntrg.co.uk/sci/1.0/sci.schema.json", "id": "pmid:32098132", "kind": "science-record", "revision": 5, "content_hash": "sha256:56e8dc0c0d18a6cf26a767d85ca78440c6bfdb29e3a3cf26553ccd659bf4fa0c", "created_at": "2026-11-01T15:40:56Z", "updated_at": "2026-11-01T18:52:01Z", "generator": {"name": "corpus-assay-engine", "run_id": "reading-sci-2026-11-01"}, "paper": {"state": "complete", "title": "A High Resolution Mass Spectrometry Study Reveals the Potential of Disulfide Formation in Human Mitochondrial Voltage-Dependent Anion Selective Channel Isoforms (hVDACs).", "doi": "10.3390/ijms21041468", "pmid": "32098132", "authors": ["Maria G G Pittalà", "Rosaria Saletti", "Simona Reina", "Vincenzo Cunsolo", "Vito De Pinto", "Salvatore Foti"], "journal": "International journal of molecular sciences", "year": 2020, "abstract": "The voltage-dependent anion-selective channels (VDACs), which are also known as eukaryotic porins, are pore-forming proteins, which allow for the passage of ions and small molecules across the outer mitochondrial membrane (OMM). They are involved in complex interactions that regulate organelle and cellular metabolism. We have recently reported the post-translational modifications (PTMs) of the three VDAC isoforms purified from rat liver mitochondria (rVDACs), showing, for the first time, the over-oxidation of the cysteine residues as an exclusive feature of VDACs. Noteworthy, this peculiar PTM is not detectable in other integral membrane mitochondrial proteins, as defined by their elution at low salt concentration by a hydroxyapatite column. In this study, the association of tryptic and chymotryptic proteolysis with UHPLC/High Resolution nESI-MS/MS, allowed for us to extend the investigation to the human VDACs. The over-oxidation of the cysteine residues, essentially irreversible in cell conditions, was as also certained in VDAC isoforms from human cells. In human VDAC2 and 3 isoforms the permanently reduced state of a cluster of close cysteines indicates the possibility that disulfide bridges are formed in the proteins. Importantly, the detailed oxidative PTMs that are found in human VDACs confirm and sustain our previous findings in rat tissues, claiming for a predictable characterization that has to be conveyed in the functional role of VDAC proteins within the cell. Data are available via ProteomeXchange with identifier PXD017482.", "claims": [{"id": "claim-data-access", "statement": "The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium (http://proteomecentral.proteomexchange.org) via the PRIDE partner repository [28] with the dataset identifier PXD017482.", "kind": "methodological", "target": null, "evidence": [{"asset": "source:pmid:32098132", "locator": "sections[14] \"4.4. Database Search\" paragraph 3", "quote": "The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium (http://proteomecentral.proteomexchange.org) via the PRIDE partner repository [28] with the dataset identifier PXD017482."}], "state": "complete"}], "gaps": []}, "experiment": {"state": "complete", "objective": null, "steps": [{"id": "read_published_estimate", "order": 1, "name": "Read the published estimate from the source", "kind": "other", "state": "complete", "blocked_on": null, "description": "The claim, method and evidence span published with the source article.", "duration_hours": null, "parameters": {}, "inputs": ["source:pmid:32098132"], "outputs": ["the published estimate and its evidence"], "instruments": [], "reagents": []}, {"id": "obtain_source_data", "order": 2, "name": "Obtain the source data from the named repository", "kind": "data-preparation", "state": "complete", "blocked_on": null, "description": "The GEO series accession resolves and its sample accessions are listed. This lane did not download the dataset or read its licence.", "duration_hours": null, "parameters": {}, "inputs": ["data:geo:PXD017482"], "outputs": ["the source data with its repository provenance"], "instruments": [], "reagents": []}, {"id": "run_analysis", "order": 3, "name": "Run the published analysis", "kind": "analysis", "state": "complete", "blocked_on": null, "description": "Apply the paper's statistical method to the resolved series and compare the result with the published target.", "duration_hours": null, "parameters": {}, "inputs": ["data:geo:PXD017482"], "outputs": ["the replicated result and its comparison"], "instruments": [], "reagents": []}], "materials": [], "instruments": [], "reagents": [], "conditions": {}, "gaps": []}, "data": {"state": "partial", "assets": [{"id": "source:pmid:32098132", "role": "manuscript", "format": "xml", "media_type": "application/xml", "uri": "https://doi.org/10.3390/ijms21041468", "sha256": "sha256:3f353ac15e6d823207bee9f302707a892d157d7194ea7c09fee9661e36a02fd6", "bytes": 52988, "access": "open", "state": "resolved", "reader": null, "reader_status": "reader_required", "identifier": "10.3390/ijms21041468", "version": null, "note": "Full article fetched from PMC; the checksum covers the rendered section body, not the original XML bytes.", "structure": {"pmcid": "PMC7073118", "source": "europe_pmc_fulltext", "coverage": "whole_body", "text_hash_scope": "rendered_section_body"}}, {"id": "data:geo:PXD017482", "role": "raw", "format": "geo-series", "media_type": "application/vnd.ncbi.geo-series+json", "uri": "https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=PXD017482", "sha256": null, "bytes": null, "access": "open", "state": "resolved", "reader": null, "reader_status": "reader_required", "identifier": "PXD017482", "version": null, "note": "The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium (http://proteomecentral.proteomexchange.org) via the PRIDE partner repository [28] with the dataset identifier PXD017482.", "structure": {"repository": "GEO", "access_route": "GEO accession URL", "access_statement_verbatim": "The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium (http://proteomecentral.proteomexchange.org) via the PRIDE partner repository [28] with the dataset identifier PXD017482.", "access_statement_kind": "data_availability_statement", "sample_accessions": [], "sample_count": null, "group_sizes": null, "group_sizes_basis": null, "platform": null, "taxon": null, "title": "A High Resolution Mass Spectrometry Study Reveals the Potential of Disulfide Formation in Human Mitochondrial Voltage-Dependent Anion Selective Channel Isoforms (hVDACs)", "resolution_checked_at": "2026-10-31T18:35:55Z", "resolution_check": "identifier_resolution_only_no_download_no_licence_read", "downloaded": false, "licence_read": false}}, {"id": "asset:table:pmid:32098132:1", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:d8affb8fed113035c24bfc7cf41f61503e90e3e32537e871bc0fcff61fd518d6", "bytes": 750, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[3]/table-wrap[1]#ijms-21-01468-t001", "version": null, "note": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC1 reduced with dithiothreitol (DTT), carboxyamidomethylated, and digested in-solution.", "structure": {"pmcid": "PMC7073118", "section_index": 3, "section_title": "2.1. Mass Spectrometry Analysis of Human VDAC1", "row_count": 5, "column_count": 5}, "table": {"label": "Table 1", "caption": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC1 reduced with dithiothreitol (DTT), carboxyamidomethylated, and digested in-solution.", "rows": [["Peptide", "Position in the Sequence", "Measured Monoisotopic m/z", "Absolute Intensity", "Ratio Ox/Red"], ["EHINLGCDM129DFDIAGPSIR", "121–139", "1083.9756 (+2)", "1.6 × 105", "1.5"], ["EHINLGCDMDFDIAGPSIR", "1075.9784 (+2)", "1.08 × 105"], ["GALVLGYEGWLAGYQM155NFETAK", "140–161", "812.0634 (+3)", "6.4 × 105", "0.8"], ["GALVLGYEGWLAGYQMNFETAK", "1209.5944 (+2)", "8.5 × 105"]], "row_count": 5, "column_count": 5, "numeric_cells": 14, "header_rows": 1, "locator": "section[3]/table-wrap[1]#ijms-21-01468-t001"}}, {"id": "asset:table:pmid:32098132:2", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:2e6c3e9db45b226a70d58c0622958a37d0f54cbafdd053eacf7ea54cff31fef2", "bytes": 1257, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[4]/table-wrap[1]#ijms-21-01468-t002", "version": null, "note": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC2 reduced with DTT, carboxyamidomethylated, and digested in-solution.", "structure": {"pmcid": "PMC7073118", "section_index": 4, "section_title": "2.2. Mass Spectrometry Analysis of Human VDAC2", "row_count": 13, "column_count": 5}, "table": {"label": "Table 2", "caption": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC2 reduced with DTT, carboxyamidomethylated, and digested in-solution.", "rows": [["Peptide", "Position in the Sequence", "Measured Monoisotopic m/z", "Absolute Intensity", "Ratio Ox/Red"], ["PMCIPPSYADLGK", "11–23", "732.8476 (+2)", "8.79 × 105", "9.8"], ["PMCIPPSYADLGK", "724.8497 (+2)", "8.99 × 104"], ["SCSGVEFSTSGSSNTDTGK", "46–64", "949.8815 (+2)", "1.80 × 104", "0.01"], ["SCSGVEFSTSGSSNTDTGK", "954.4005 (+2)", "1.59 × 106"], ["YKWCEYGLTFTEK", "73–85", "858.3821 (+2)", "1.53 × 104", "0.1"], ["YKWCEYGLTFTEK", "862.9037 (+2)", "1.38 × 105"], ["WNTDNTLGTEIAIEDQICQGLK", "86–107", "837.3958 (+3)", "1.09 × 105", "0.04"], ["WNTDNTLGTEIAIEDQICQGLK", "1260.1086 (+2)", "2.98 × 106"], ["ECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKa", "132–172", "1508.3225 (+3)", "2.94 × 104", "1.4"], ["ECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKa", "1502.9921 (+3)", "2.12 × 104"], ["VCEDLDTSVNLAWTSGTNCTR", "209–229", "1195.5161 (+2)", "4.40 × 104", "0.1"], ["VCEDLDTSVNLAWTSGTNCTR", "800.3594 (+3)", "4.40 × 105"]], "row_count": 13, "column_count": 5, "numeric_cells": 36, "header_rows": 1, "locator": "section[4]/table-wrap[1]#ijms-21-01468-t002"}}, {"id": "asset:table:pmid:32098132:3", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:314298813ce2b58161dd75d78ca1e774b5e407b5274f8af7560697831a109a68", "bytes": 1082, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[5]/table-wrap[1]#ijms-21-01468-t003", "version": null, "note": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC3 reduced with DTT, carboxyamidomethylated, and digested in-solution.", "structure": {"pmcid": "PMC7073118", "section_index": 5, "section_title": "2.3. Mass Spectrometry Analysis of Human VDAC3", "row_count": 11, "column_count": 5}, "table": {"label": "Table 3", "caption": "Comparison of the absolute intensities of molecular ions of selected sulfur containing tryptic peptides found in the analysis of hVDAC3 reduced with DTT, carboxyamidomethylated, and digested in-solution.", "rows": [["Peptide", "Position in the Sequence", "Measured Monoisotopic m/z", "Absolute Intensity", "Ratio Ox/Red"], ["GYGFGMVK", "21–28", "437.7098 (+2)", "1.46 × 104", "0.06"], ["GYGFGMVK", "429.7118 (+2)", "2.51 × 105"], ["SCSGVEFSTSGHAYTDTGK", "35–53", "991.4069 (+2)", "1.81 × 104", "0.2"], ["SCSGVEFSTSGHAYTDTGK", "995.9267 (+2)", "8.80 × 104"], ["YKVCNYGLTFTQK", "62–74", "806.8889 (+2)", "1.01 × 104", "0.05"], ["YKVCNYGLTFTQK", "811.4081 (+2)", "1.97 × 105"], ["DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAK", "121–161", "1513.3688 (+3)", "1.74 × 104", "1.1"], ["DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAK", "1508.0270 (+3)", "1.59 × 104"], ["YMLDCR", "225–230", "437.1832 (+2)", "5.88 × 105", "3.2"], ["YMLDCR", "429.1861 (+2)", "1.86 × 105"]], "row_count": 11, "column_count": 5, "numeric_cells": 30, "header_rows": 1, "locator": "section[5]/table-wrap[1]#ijms-21-01468-t003"}}, {"id": "asset:table:pmid:32098132:4", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:3b1153c7f5f12f187da81e6642e7c9dfc8595a97fa1ed80b8392b048e4889767", "bytes": 1406, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[6]/table-wrap[1]#ijms-21-01468-t004", "version": null, "note": "Comparison of the oxidation state of cysteines in rat and human VDAC isoforms. p. o.: partially oxidized; t.o.: totally oxidized; t.r.: totally reduced; rat: VDACs from rat liver; hu: VDACs from human HAP1 cells. Cysteine residues are aligned in the same rows according to their presumed homology.", "structure": {"pmcid": "PMC7073118", "section_index": 6, "section_title": "3. Discussion", "row_count": 17, "column_count": 12}, "table": {"label": "Table 4", "caption": "Comparison of the oxidation state of cysteines in rat and human VDAC isoforms. p. o.: partially oxidized; t.o.: totally oxidized; t.r.: totally reduced; rat: VDACs from rat liver; hu: VDACs from human HAP1 cells. Cysteine residues are aligned in the same rows according to their presumed homology.", "rows": [["Cysteine Position", "Oxidative State"], ["VDAC1", "VDAC2", "VDAC3", "VDAC1", "VDAC2", "VDAC3"], ["rat", "hu", "rat", "hu", "rat", "hu", "rat", "hu", "rat", "hu", "rat", "hu"], ["", "", "4", "", "", "", "", "", "t.r.", "", "", ""], ["", "", "5", "", "", "", "", "", "t.r.", "", "", ""], ["", "", "9", "8", "2", "2", "", "-", "t.r.", "t.r.", "t.r.", "t.r."], ["", "", "14", "13", "8", "8", "", "-", "t.r.", "t.r.", "t.r.", "t.r."], ["", "", "48", "47", "36", "36", "", "-", "p.o.", "p.o.", "p.o.", "p.o."], ["", "", "77", "76", "65", "65", "", "-", "p.o.", "p.o.", "p.o.", "p.o."], ["", "", "104", "103", "", "-", "", "-", "p.o.", "p.o.", "", "-"], ["", "", "134", "133", "122", "122", "", "-", "N.D.", "t.r.", "N.D.", "t.r."], ["127", "127", "139", "138", "", "-", "p.o.", "t.o.", "N.D.", "t.o.", "", "-"], ["", "", "", "", "165", "", "", "", "", "", "p.o.", ""], ["", "", "211", "210", "", "-", "", "-", "p.o.", "p.o.", "", "-"], ["", "", "228", "227", "", "-", "", "-", "p.o.", "t.r.", "", "-"], ["", "", "", "", "229", "229", "", "-", "", "-", "t.o.", "t.r."], ["232", "232", "", "", "", "-", "p.o.", "t.r.", "", "-", "", "-"]], "row_count": 17, "column_count": 12, "numeric_cells": 37, "header_rows": 3, "locator": "section[6]/table-wrap[1]#ijms-21-01468-t004"}}, {"id": "asset:table:pmid:32098132:5", "role": "table", "format": "jats-table", "media_type": "application/vnd.jats.table+json", "uri": null, "sha256": "sha256:c58754259e97939aa950506f3948f619bb60da8928d1926bd0062ca0c8f1163d", "bytes": 484, "access": "open", "state": "verified", "reader": "read_table", "reader_status": "available", "identifier": "section[17]/table-wrap[1]#array1", "version": null, "note": null, "structure": {"pmcid": "PMC7073118", "section_index": 17, "section_title": "Abbreviations", "row_count": 9, "column_count": 2}, "table": {"label": null, "caption": null, "rows": [["PBS", "phosphate buffered saline"], ["EGTA", "ethylene glycol tetraacetic acid"], ["EDTA", "ethylenediaminetetraacetic acid"], ["FA", "formic acid"], ["HEPES", "4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid"], ["DTT", "dithiothreitol"], ["IAA", "iodoacetamide"], ["FBS", "fetal bovine serum"], ["IMDM", "Iscove’s Modified Dulbecco’s Medium"]], "row_count": 9, "column_count": 2, "numeric_cells": 1, "header_rows": 0, "locator": "section[17]/table-wrap[1]#array1"}}], "gaps": ["asset:data:geo:PXD017482 not downloaded", "asset:data:geo:PXD017482 licence not read"]}, "analysis": {"state": "absent", "methods": [], "targets": [], "gaps": ["method", "operations"]}, "capability": {"state": "complete", "requirements": [{"capability_id": "capability:computational_analysis", "label": "Computational analysis platform", "assay_families": ["meta_analysis", "machine_learning", "survival_analysis", "statistical_regression", "pca", "molecular_docking", "network_analysis", "differential_expression", "gwas"], "availability_state": "owned", "tier_unlocked": "R1", "candidate": "Automated Assays Laravel application and simulated adapters"}], "gaps": []}, "readiness": {"state": "blocked", "tier": "R4", "blocking_axis": "method", "blocked_on": "method:not_determinable", "axes": {"method": {"tier": "R4", "expressible": false, "required_operations": [], "missing_operations": [], "basis": "The reader quoted the method the paper names (not named), but the corpus's method extractor could not map it onto a DSL operation, so the method is published but not expressible."}, "capability": {"tier": "R1", "capability_id": "capability:computational_analysis", "availability_state": "owned", "basis": "The computational analysis is owned. The physical bench the paper used is not, so a physical validation cannot be run here."}, "data": {"tier": "R1", "reachable": true, "accessions": ["PXD017482"], "resolved_accessions": ["PXD017482"], "statements": ["The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium (http://proteomecentral.proteomexchange.org) via the PRIDE partner repository [28] with the dataset identifier PXD017482."], "basis": "The paper names PXD017482 in ProteomeXchange Consortium via the PRIDE partner repository and the accession resolves in the repository. No dataset was downloaded and no licence was read."}}, "can_run": {"dsl_operations": [], "assets": ["source:pmid:32098132", "data:geo:PXD017482", "asset:table:pmid:32098132:1", "asset:table:pmid:32098132:2", "asset:table:pmid:32098132:3", "asset:table:pmid:32098132:4", "asset:table:pmid:32098132:5"], "steps": ["run_analysis"]}, "must_build": {"dsl_operations": [], "converters": [], "readers": [], "capabilities": [], "data_gaps": ["data:geo:PXD017482"]}, "gaps": ["method:not_determinable"]}, "review": {"state": "partial", "machine_critique": {"kind": "extraction_review", "reader": {"model": "MiniMax-M3.1-Flash", "provider": "minimax", "provider_family": "minimax", "read_at": "2026-10-31T18:18:41Z", "independence": "single_reader"}, "evidence_check": {"method": null, "availability": "verbatim"}, "calls": 3, "usage": {"prompt_tokens": 42453, "completion_tokens": 892, "cached_tokens": 14336}}, "human_critique": null, "stages": [{"id": "extraction", "state": "complete", "reader": "MiniMax-M3.1-Flash", "provider": "minimax"}], "gaps": ["review.independent_reader", "review.machine_critique", "review.human_critique"]}, "execution": {"state": "absent", "status": "not_run", "mode": null, "runs": [], "gaps": ["execution.not_run"]}, "provenance": {"entities": [{"id": "pmid:32098132", "type": "paper", "label": "pmid:32098132"}, {"id": "source:pmid:32098132", "type": "manuscript", "label": "PMID 32098132 full text"}, {"id": "data:geo:PXD017482", "type": "dataset", "label": "GEO PXD017482"}], "activities": [{"id": "activity-reading-sci-2026-11-01", "type": "classification", "used": [{"id": "pmid:32098132", "type": "paper", "label": "pmid:32098132"}, {"id": "source:pmid:32098132", "type": "manuscript", "label": "PMID 32098132 full text"}, {"id": "data:geo:PXD017482", "type": "dataset", "label": "GEO PXD017482"}], "agent": "agent:corpus-assay-engine"}, {"id": "activity-read-32098132", "type": "extraction", "used": ["source:pmid:32098132"], "agent": "agent:minimax-reader"}, {"id": "activity-resolve-PXD017482", "type": "accession_resolution", "used": ["data:geo:PXD017482"], "agent": "agent:corpus-assay-engine"}], "agents": [{"id": "agent:corpus-assay-engine", "type": "software", "label": "Corpus assay engine"}, {"id": "agent:minimax-reader", "type": "software", "label": "MiniMax literature reader"}], "source_run_id": "reading-sci-2026-11-01", "dsl_catalogue_fingerprint": "343fb30756ba6ec3", "capability_table_fingerprint": "2cb3e42f047d2ecf", "snapshot_id": "ba34b49490d9bfaf"}, "lineage": {"parent_id": "pmid:32098132", "parent_hash": "sha256:dcf10792066cadcb1217d1b4bb3e3f9c4772036d30200989725e952c23b82d94", "fork_of": null, "generation": 4}, "gaps": ["asset:data:geo:PXD017482 licence not read", "asset:data:geo:PXD017482 not downloaded", "execution.not_run", "method", "operations", "review.human_critique", "review.independent_reader", "review.machine_critique"], "assays": [{"role": "data_generation", "definition_id": "mass_spectrometry", "definition_version": "99e1195c7d6f", "definition_digest": null, "required_operations": [], "support_state": "partial", "source_hashes": {"assay_lexicon": "99e1195c7d6f"}, "confidence": 0.99, "evidence": ["A High Resolution Mass Spectrometry Study Reveals the Potential of Disulfide For", "2.1. Mass Spectrometry Analysis of Human VDAC1 Reduction/alkylation", "ested by trypsin and hereinafter analyzed by mass spectrometry. In this experiment, every protein in the HT", "nd 31), as found in the tryptic digest. 2.2. Mass Spectrometry Analysis of Human VDAC2 The peptides that we"], "order_basis": "paper_text_order:0", "id": "assay:1"}, {"role": "data_generation", "definition_id": "animal_model", "definition_version": "99e1195c7d6f", "definition_digest": null, "required_operations": [], "support_state": "partial", "source_hashes": {"assay_lexicon": "99e1195c7d6f"}, "confidence": 0.834, "evidence": ["Ms) of the three VDAC isoforms purified from rat liver mitochondria (rVDACs), showing, for th", "confirm and sustain our previous findings in rat tissues, claiming for a predictable characte"], "order_basis": "paper_text_order:557", "id": "assay:2"}, {"role": "data_generation", "definition_id": "cell_culture", "definition_version": "99e1195c7d6f", "definition_digest": null, "required_operations": [], "support_state": "partial", "source_hashes": {"assay_lexicon": "99e1195c7d6f"}, "confidence": 0.77, "evidence": ["der Reducing Condition Human HAP1 cells were cultured in monolayer (75 cm2 tissue culture flask) unti"], "order_basis": "paper_text_order:16755", "id": "assay:3"}]}